Lineage for d1ie7c2 (1ie7 C:132-434,C:484-570)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2442004Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2442071Family c.1.9.2: alpha-subunit of urease, catalytic domain [51560] (1 protein)
  6. 2442072Protein alpha-subunit of urease, catalytic domain [51561] (4 species)
  7. 2442073Species Bacillus pasteurii [TaxId:1474] [51563] (9 PDB entries)
  8. 2442079Domain d1ie7c2: 1ie7 C:132-434,C:484-570 [62316]
    Other proteins in same PDB: d1ie7a_, d1ie7b_, d1ie7c1
    complexed with ni, po4

Details for d1ie7c2

PDB Entry: 1ie7 (more details), 1.85 Å

PDB Description: phosphate inhibited bacillus pasteurii urease crystal structure
PDB Compounds: (C:) urease alpha subunit

SCOPe Domain Sequences for d1ie7c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ie7c2 c.1.9.2 (C:132-434,C:484-570) alpha-subunit of urease, catalytic domain {Bacillus pasteurii [TaxId: 1474]}
ggidthvhfinpdqvdvalangittlfgggtgpaegskattvtpgpwniekmlksteglp
invgilgkghgssiapimeqidagaaglkihedwgatpasidrsltvadeadvqvaihsd
tlneagfledtlraingrvihsfhvegaggghapdimamaghpnvlpsstnptrpftvnt
idehldmlmvchhlknnipedvafadsrirpetiaaedilhdlgiismmstdalamgrag
emvlrtwqtadkmkkqrgplaeekngsdnfrlkryvskytinpaiaqgiahevgsieegk
fadXgdlihdtnitfmskssiqqgvpaklglkrrigtvkncrnigkkdmkwndvttdidi
npetyevkvdgevltcepvkelpmaqryflf

SCOPe Domain Coordinates for d1ie7c2:

Click to download the PDB-style file with coordinates for d1ie7c2.
(The format of our PDB-style files is described here.)

Timeline for d1ie7c2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ie7c1