SCOP 1.67: Domain d1ie7c2: 1ie7 C:132-434,C:484-570

Lineage for d1ie7c2 (1ie7 C:132-434,C:484-570)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.2: alpha-subunit of urease, catalytic domain [51560] (1 protein)

6. Protein alpha-subunit of urease, catalytic domain [51561] (3 species)

7. Species Bacillus pasteurii [TaxId:1474] [51563] (6 PDB entries)

8. Domain d1ie7c2: 1ie7 C:132-434,C:484-570 [62316]
   Other proteins in same PDB: d1ie7a_, d1ie7b_, d1ie7c1
   complexed with ni, po4

Details for d1ie7c2

PDB Entry: 1ie7, 1.85 Å

PDB Description: phosphate inhibited bacillus pasteurii urease crystal structure

SCOP Domain Sequences for d1ie7c2:

Sequence; same for both SEQRES and ATOM records:

>d1ie7c2 c.1.9.2 (C:132-434,C:484-570) alpha-subunit of urease, catalytic domain {Bacillus pasteurii}
ggidthvhfinpdqvdvalangittlfgggtgpaegskattvtpgpwniekmlksteglp
invgilgkghgssiapimeqidagaaglkihedwgatpasidrsltvadeadvqvaihsd
tlneagfledtlraingrvihsfhvegaggghapdimamaghpnvlpsstnptrpftvnt
idehldmlmvchhlknnipedvafadsrirpetiaaedilhdlgiismmstdalamgrag
emvlrtwqtadkmkkqrgplaeekngsdnfrlkryvskytinpaiaqgiahevgsieegk
fadXgdlihdtnitfmskssiqqgvpaklglkrrigtvkncrnigkkdmkwndvttdidi
npetyevkvdgevltcepvkelpmaqryflf

Timeline for d1ie7c2:

• d1ie7c2 first appeared in SCOP 1.57
  
• d1ie7c2 appears in SCOP 1.65
  
• d1ie7c2 appears in SCOP 1.69
  
• d1ie7c2 appears in the current release, SCOPe 2.08