Lineage for d1ie7c1 (1ie7 C:1-131,C:435-483)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2084271Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2084272Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2084273Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)
  6. 2084274Protein alpha-Subunit of urease [51340] (4 species)
  7. 2084275Species Bacillus pasteurii [TaxId:1474] [51342] (9 PDB entries)
  8. 2084281Domain d1ie7c1: 1ie7 C:1-131,C:435-483 [62315]
    Other proteins in same PDB: d1ie7a_, d1ie7b_, d1ie7c2
    complexed with ni, po4

Details for d1ie7c1

PDB Entry: 1ie7 (more details), 1.85 Å

PDB Description: phosphate inhibited bacillus pasteurii urease crystal structure
PDB Compounds: (C:) urease alpha subunit

SCOPe Domain Sequences for d1ie7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ie7c1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease {Bacillus pasteurii [TaxId: 1474]}
mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
viaaegkivtaXlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmygt
v

SCOPe Domain Coordinates for d1ie7c1:

Click to download the PDB-style file with coordinates for d1ie7c1.
(The format of our PDB-style files is described here.)

Timeline for d1ie7c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ie7c2