Lineage for d1ie7c1 (1ie7 C:1-131,C:435-483)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 172428Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
  4. 172429Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (3 families) (S)
  5. 172430Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein)
  6. 172431Protein alpha-Subunit of urease [51340] (3 species)
  7. 172432Species Bacillus pasteurii [TaxId:1474] [51342] (5 PDB entries)
  8. 172435Domain d1ie7c1: 1ie7 C:1-131,C:435-483 [62315]
    Other proteins in same PDB: d1ie7a_, d1ie7b_, d1ie7c2

Details for d1ie7c1

PDB Entry: 1ie7 (more details), 1.85 Å

PDB Description: phosphate inhibited bacillus pasteurii urease crystal structure

SCOP Domain Sequences for d1ie7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ie7c1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease {Bacillus pasteurii}
mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
viaaegkivtaXlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmygt
v

SCOP Domain Coordinates for d1ie7c1:

Click to download the PDB-style file with coordinates for d1ie7c1.
(The format of our PDB-style files is described here.)

Timeline for d1ie7c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ie7c2