![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) ![]() |
![]() | Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins) |
![]() | Protein Urease, beta-subunit [51280] (4 species) |
![]() | Species Bacillus pasteurii [TaxId:1474] [51282] (11 PDB entries) |
![]() | Domain d1ie7b_: 1ie7 B: [62314] Other proteins in same PDB: d1ie7a_, d1ie7c1, d1ie7c2 complexed with ni, po4 |
PDB Entry: 1ie7 (more details), 1.85 Å
SCOPe Domain Sequences for d1ie7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ie7b_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii [TaxId: 1474]} nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg ve
Timeline for d1ie7b_: