Lineage for d1ie7b_ (1ie7 B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 471373Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 471434Superfamily b.85.3: Urease, beta-subunit [51278] (1 family) (S)
  5. 471435Family b.85.3.1: Urease, beta-subunit [51279] (1 protein)
  6. 471436Protein Urease, beta-subunit [51280] (3 species)
  7. 471437Species Bacillus pasteurii [TaxId:1474] [51282] (6 PDB entries)
  8. 471440Domain d1ie7b_: 1ie7 B: [62314]
    Other proteins in same PDB: d1ie7a_, d1ie7c1, d1ie7c2

Details for d1ie7b_

PDB Entry: 1ie7 (more details), 1.85 Å

PDB Description: phosphate inhibited bacillus pasteurii urease crystal structure

SCOP Domain Sequences for d1ie7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ie7b_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

SCOP Domain Coordinates for d1ie7b_:

Click to download the PDB-style file with coordinates for d1ie7b_.
(The format of our PDB-style files is described here.)

Timeline for d1ie7b_: