![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.8: Urease, gamma-subunit [54110] (1 superfamily) alpha(3)-beta(2); antiparallel hairpin |
![]() | Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) ![]() |
![]() | Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins) automatically mapped to Pfam PF00547 |
![]() | Protein Urease, gamma-subunit [54113] (4 species) |
![]() | Species Bacillus pasteurii [TaxId:1474] [54115] (9 PDB entries) |
![]() | Domain d1ie7a_: 1ie7 A: [62313] Other proteins in same PDB: d1ie7b_, d1ie7c1, d1ie7c2 complexed with ni, po4 |
PDB Entry: 1ie7 (more details), 1.85 Å
SCOPe Domain Sequences for d1ie7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ie7a_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii [TaxId: 1474]} mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
Timeline for d1ie7a_: