Lineage for d1ie7a_ (1ie7 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175263Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 2175264Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) (S)
  5. 2175265Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
    automatically mapped to Pfam PF00547
  6. 2175266Protein Urease, gamma-subunit [54113] (4 species)
  7. 2175267Species Bacillus pasteurii [TaxId:1474] [54115] (9 PDB entries)
  8. 2175273Domain d1ie7a_: 1ie7 A: [62313]
    Other proteins in same PDB: d1ie7b_, d1ie7c1, d1ie7c2
    complexed with ni, po4

Details for d1ie7a_

PDB Entry: 1ie7 (more details), 1.85 Å

PDB Description: phosphate inhibited bacillus pasteurii urease crystal structure
PDB Compounds: (A:) urease gamma subunit

SCOPe Domain Sequences for d1ie7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ie7a_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii [TaxId: 1474]}
mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

SCOPe Domain Coordinates for d1ie7a_:

Click to download the PDB-style file with coordinates for d1ie7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ie7a_: