Lineage for d1ie7a_ (1ie7 A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 188733Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
  4. 188734Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) (S)
  5. 188735Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
  6. 188736Protein Urease, gamma-subunit [54113] (3 species)
  7. 188737Species Bacillus pasteurii [TaxId:1474] [54115] (5 PDB entries)
  8. 188740Domain d1ie7a_: 1ie7 A: [62313]
    Other proteins in same PDB: d1ie7b_, d1ie7c1, d1ie7c2

Details for d1ie7a_

PDB Entry: 1ie7 (more details), 1.85 Å

PDB Description: phosphate inhibited bacillus pasteurii urease crystal structure

SCOP Domain Sequences for d1ie7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ie7a_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii}
mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

SCOP Domain Coordinates for d1ie7a_:

Click to download the PDB-style file with coordinates for d1ie7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ie7a_: