SCOPe 2.05: Domain d1ie5a_: 1ie5 A:

Lineage for d1ie5a_ (1ie5 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Neural cell adhesion molecule (NCAM) [49166] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [63664] (1 PDB entry)

8. Domain d1ie5a_: 1ie5 A: [62312]
   module 3

Details for d1ie5a_

PDB Entry: 1ie5

PDB Description: nmr structure of the third immunoglobulin domain from the neural cell adhesion molecule.

PDB Compounds: (A:) neural cell adhesion molecule

SCOPe Domain Sequences for d1ie5a_:

Sequence; same for both SEQRES and ATOM records:

>d1ie5a_ b.1.1.4 (A:) Neural cell adhesion molecule (NCAM) {Chicken (Gallus gallus) [TaxId: 9031]}
gkdiqvivnvppsvrarqstmnatanlsqsvtlacdadgfpeptmtwtkdgepieqedne
ekysfnydgseliikkvdksdeaeyiciaenkageqdatihlkvfak

Timeline for d1ie5a_:

• d1ie5a_ first appeared in SCOP 1.57
  
• d1ie5a_ appears in SCOPe 2.04
  
• d1ie5a_ is called d1ie5a1 in SCOPe 2.06
  
• d1ie5a_ appears in the current release, SCOPe 2.08, called d1ie5a1