Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Neural cell adhesion molecule (NCAM) [49166] (2 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [63664] (1 PDB entry) |
Domain d1ie5a_: 1ie5 A: [62312] module 3 |
PDB Entry: 1ie5 (more details)
SCOPe Domain Sequences for d1ie5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ie5a_ b.1.1.4 (A:) Neural cell adhesion molecule (NCAM) {Chicken (Gallus gallus) [TaxId: 9031]} gkdiqvivnvppsvrarqstmnatanlsqsvtlacdadgfpeptmtwtkdgepieqedne ekysfnydgseliikkvdksdeaeyiciaenkageqdatihlkvfak
Timeline for d1ie5a_: