Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein Malate dehydrogenase [56329] (12 species) |
Species Escherichia coli [TaxId:562] [56333] (4 PDB entries) |
Domain d1ie3c2: 1ie3 C:146-312 [62309] Other proteins in same PDB: d1ie3a1, d1ie3b1, d1ie3c1, d1ie3d1 complexed with nad, pyr |
PDB Entry: 1ie3 (more details), 2.5 Å
SCOPe Domain Sequences for d1ie3c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ie3c2 d.162.1.1 (C:146-312) Malate dehydrogenase {Escherichia coli [TaxId: 562]} vttldiicsntfvaelkgkqpgevevpvigghsgvtilpllsqvpgvsfteqevadltkr iqnagtevveakagggsatlsmgqaaarfglslvralqgeqgvvecayvegdgqyarffs qplllgkngveerksigtlsafeqnalegmldtlkkdialgqefvnk
Timeline for d1ie3c2: