Lineage for d1idua_ (1idu A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006107Fold a.111: Acid phosphatase/Vanadium-dependent haloperoxidase [48316] (1 superfamily)
    multihelical; core: 5-helical bundle; binds cofactor at the beginning of third helix
  4. 2006108Superfamily a.111.1: Acid phosphatase/Vanadium-dependent haloperoxidase [48317] (4 families) (S)
  5. 2006139Family a.111.1.3: Chloroperoxidase [48325] (2 protein domains)
    duplication: contains two core bundles arranged as in the other family dimer
  6. 2006140Protein Chloroperoxidase [48326] (1 species)
  7. 2006141Species Curvularia inaequalis [TaxId:38902] [48327] (9 PDB entries)
  8. 2006149Domain d1idua_: 1idu A: [62303]
    complexed with vo4

Details for d1idua_

PDB Entry: 1idu (more details), 2.24 Å

PDB Description: crystal structure of the peroxide form of the vanadium-containing chloroperoxidase from curvularia inaequalis
PDB Compounds: (A:) vanadium chloroperoxidase

SCOPe Domain Sequences for d1idua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1idua_ a.111.1.3 (A:) Chloroperoxidase {Curvularia inaequalis [TaxId: 38902]}
svtpiplpkidepeeyntnyilfwnhvglelnrvthtvggpltgpplsaralgmlhlaih
dayfsicpptdfttflspdtenaayrlpspngandarqavagaalkmlsslymkpveqpn
pnpganisdnayaqlglvldrsvleapggvdresasfmfgedvadvffallndprgasqe
gynptpgrykfddepthpvvlipvdpnnpngpkmpfrqyhapfygkttkrfatqsehfla
dppglrsnadetaeyddavrvaiamggaqalnstkrspwqtaqglywaydgsnligtppr
fynqivrriavtykkeedlansevnnadfarlfalvdvactdagifswkekwefefwrpl
sgvrddgrpdhgdpfwltlgapatntndipfkppfpaypsghatfggavfqmvrryyngr
vgtwkddepdniaidmmiseelngvnrdlrqpydptapiedqpgivrtrivrhfdsawel
mfenaisriflgvhwrfdaaaardiliptttkdvyavdnngatvfqnvediryttrgtre
deeglfpiggvplgieiadeifnnglkptppeiqpm

SCOPe Domain Coordinates for d1idua_:

Click to download the PDB-style file with coordinates for d1idua_.
(The format of our PDB-style files is described here.)

Timeline for d1idua_: