Lineage for d1idrb_ (1idr B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43954Family a.1.1.1: Truncated hemoglobin [46459] (1 protein)
  6. 43955Protein Truncated hemoglobin [46460] (3 species)
  7. 43960Species Mycobacterium tuberculosis [TaxId:1773] [63437] (1 PDB entry)
  8. 43962Domain d1idrb_: 1idr B: [62302]

Details for d1idrb_

PDB Entry: 1idr (more details), 1.9 Å

PDB Description: crystal structure of the truncated-hemoglobin-n from mycobacterium tuberculosis

SCOP Domain Sequences for d1idrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1idrb_ a.1.1.1 (B:) Truncated hemoglobin {Mycobacterium tuberculosis}
gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
lavdvt

SCOP Domain Coordinates for d1idrb_:

Click to download the PDB-style file with coordinates for d1idrb_.
(The format of our PDB-style files is described here.)

Timeline for d1idrb_: