SCOPe 2.07: Domain d1idra_: 1idr A:

Lineage for d1idra_ (1idr A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
   lack the first helix (A)

6. Protein Protozoan/bacterial hemoglobin [46460] (6 species)

7. Species Mycobacterium tuberculosis, HbN [TaxId:1773] [63437] (8 PDB entries)
   Uniprot Q10784

8. Domain d1idra_: 1idr A: [62301]
   complexed with hem, oxy, po4

Details for d1idra_

PDB Entry: 1idr, 1.9 Å

PDB Description: crystal structure of the truncated-hemoglobin-n from mycobacterium tuberculosis

PDB Compounds: (A:) hemoglobin hbn

SCOPe Domain Sequences for d1idra_:

Sequence; same for both SEQRES and ATOM records:

>d1idra_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}
gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
lavdvts

Timeline for d1idra_:

• d1idra_ first appeared in SCOP 1.57
  
• d1idra_ appears in SCOPe 2.06
  
• d1idra_ appears in the current release, SCOPe 2.08