Lineage for d1idra_ (1idr A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 93449Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 93450Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 93451Family a.1.1.1: Truncated hemoglobin [46459] (1 protein)
  6. 93452Protein Truncated hemoglobin [46460] (3 species)
  7. 93457Species Mycobacterium tuberculosis [TaxId:1773] [63437] (1 PDB entry)
  8. 93458Domain d1idra_: 1idr A: [62301]

Details for d1idra_

PDB Entry: 1idr (more details), 1.9 Å

PDB Description: crystal structure of the truncated-hemoglobin-n from mycobacterium tuberculosis

SCOP Domain Sequences for d1idra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1idra_ a.1.1.1 (A:) Truncated hemoglobin {Mycobacterium tuberculosis}
gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
lavdvts

SCOP Domain Coordinates for d1idra_:

Click to download the PDB-style file with coordinates for d1idra_.
(The format of our PDB-style files is described here.)

Timeline for d1idra_: