Lineage for d1idra_ (1idr A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299349Family a.1.1.1: Truncated hemoglobin [46459] (2 protein domains)
    lack the first helix (A)
  6. 2299350Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. 2299359Species Mycobacterium tuberculosis, HbN [TaxId:1773] [63437] (8 PDB entries)
    Uniprot Q10784
  8. 2299364Domain d1idra_: 1idr A: [62301]
    complexed with hem, oxy, po4

Details for d1idra_

PDB Entry: 1idr (more details), 1.9 Å

PDB Description: crystal structure of the truncated-hemoglobin-n from mycobacterium tuberculosis
PDB Compounds: (A:) hemoglobin hbn

SCOPe Domain Sequences for d1idra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1idra_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}
gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
lavdvts

SCOPe Domain Coordinates for d1idra_:

Click to download the PDB-style file with coordinates for d1idra_.
(The format of our PDB-style files is described here.)

Timeline for d1idra_: