Lineage for d1idla_ (1idl A:)
- Root: SCOP 1.57
Class g: Small proteins [56992] (56 folds) 
Fold g.7: Snake toxin-like [57301] (1 superfamily) Superfamily g.7.1: Snake toxin-like [57302] (3 families) 
Family g.7.1.1: Snake venom toxins [57303] (21 proteins) 
Protein Bungarotoxin [57324] (3 species) 
Species Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId:8616] [57325] (14 PDB entries) 
Domain d1idla_: 1idl A: [62299]
Details for d1idla_
PDB Entry: 1idl (more details)
PDB Description: the nmr solution structure of alpha-bungarotoxin
SCOP Domain Sequences for d1idla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1idla_ g.7.1.1 (A:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin}
ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
stdkcnphpkqrpg
SCOP Domain Coordinates for d1idla_:
Click to download the PDB-style file with coordinates for d1idla_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1idla_:
- d1idla_ is new in SCOP 1.57
- d1idla_ appears in SCOP 1.59
- d1idla_ appears in the current release, SCOPe 2.08
View in 3D