SCOP 1.73: Domain d1id5i_: 1id5 I:

Lineage for d1id5i_ (1id5 I:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology with the crossing loops

4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family)

5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein)

6. Protein Ecotin, trypsin inhibitor [49774] (1 species)

7. Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)

8. Domain d1id5i_: 1id5 I: [62294]
   Other proteins in same PDB: d1id5.1
   complexed with ca, trs; mutant

Details for d1id5i_

PDB Entry: 1id5, 2.5 Å

PDB Description: crystal structure of bovine thrombin complex with protease inhibitor ecotin

PDB Compounds: (I:) ecotin

SCOP Domain Sequences for d1id5i_:

Sequence; same for both SEQRES and ATOM records:

>d1id5i_ b.16.1.1 (I:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
qplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktl
egwgydyyvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvd
vkyrvwkaeekidnavvr

Timeline for d1id5i_:

• d1id5i_ first appeared in SCOP 1.57
  
• d1id5i_ appears in SCOP 1.71
  
• d1id5i_ appears in SCOP 1.75
  
• d1id5i_ appears in the current release, SCOPe 2.08