SCOP 1.69: Domain d1id5.1: 1id5 L:,H:

Lineage for d1id5.1 (1id5 L:,H:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50533] (26 PDB entries)

8. Domain d1id5.1: 1id5 L:,H: [62293]
   Other proteins in same PDB: d1id5i_

Details for d1id5.1

PDB Entry: 1id5, 2.5 Å

PDB Description: crystal structure of bovine thrombin complex with protease inhibitor ecotin

SCOP Domain Sequences for d1id5.1:

Sequence; same for both SEQRES and ATOM records:

>g1id5.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus)}
geadcglrplfekkqvqdqtekelfesyieXivegqdaevglspwqvmlfrkspqellcg
aslisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldkiyihpr
ynwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgnrretwt
tsvaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdacegdsggpf
vmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidr

Timeline for d1id5.1:

• d1id5.1 first appeared in SCOP 1.57
  
• d1id5.1 appears in SCOP 1.67
  
• d1id5.1 appears in SCOP 1.71
  
• d1id5.1 appears in the current release, SCOPe 2.08