Lineage for d1id2b_ (1id2 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1774128Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1774129Protein Amicyanin [49505] (2 species)
  7. 1774195Species Paracoccus versutus (Thiobacillus versutus) [TaxId:34007] [63685] (1 PDB entry)
  8. 1774197Domain d1id2b_: 1id2 B: [62289]
    complexed with cu

Details for d1id2b_

PDB Entry: 1id2 (more details), 2.15 Å

PDB Description: crystal structure of amicyanin from paracoccus versutus (thiobacillus versutus)
PDB Compounds: (B:) amicyanin

SCOPe Domain Sequences for d1id2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1id2b_ b.6.1.1 (B:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]}
qdkitvtsekpvaaadvpadavvvgiekmkyltpevtikagetvywvngevmphnvafkk
givgedafrgemmtkdqayaitfneagsydyfctphpfmrgkvive

SCOPe Domain Coordinates for d1id2b_:

Click to download the PDB-style file with coordinates for d1id2b_.
(The format of our PDB-style files is described here.)

Timeline for d1id2b_: