Lineage for d1id2a_ (1id2 A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106628Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 106629Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 106630Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 106631Protein Amicyanin [49505] (2 species)
  7. 106641Species Paracoccus versutus (Thiobacillus versutus) [TaxId:34007] [63685] (1 PDB entry)
  8. 106642Domain d1id2a_: 1id2 A: [62288]

Details for d1id2a_

PDB Entry: 1id2 (more details), 2.15 Å

PDB Description: crystal structure of amicyanin from paracoccus versutus (thiobacillus versutus)

SCOP Domain Sequences for d1id2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus)}
qdkitvtsekpvaaadvpadavvvgiekmkyltpevtikagetvywvngevmphnvafkk
givgedafrgemmtkdqayaitfneagsydyfctphpfmrgkvive

SCOP Domain Coordinates for d1id2a_:

Click to download the PDB-style file with coordinates for d1id2a_.
(The format of our PDB-style files is described here.)

Timeline for d1id2a_: