Lineage for d1icuc_ (1icu C:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 728985Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 728986Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (2 families) (S)
  5. 728987Family d.90.1.1: NADH oxidase/flavin reductase [55470] (8 proteins)
  6. 729028Protein Oxygen-insensitive NAD(P)H nitroreductase [55476] (3 species)
  7. 729049Species Escherichia coli, minor form, NfnB [TaxId:562] [55478] (12 PDB entries)
  8. 729062Domain d1icuc_: 1icu C: [62280]

Details for d1icuc_

PDB Entry: 1icu (more details), 1.8 Å

PDB Description: the structure of escherichia coli nitroreductase complexed with nicotinic acid
PDB Compounds: (C:) oxygen-insensitive nad(p)h nitroreductase

SCOP Domain Sequences for d1icuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1icuc_ d.90.1.1 (C:) Oxygen-insensitive NAD(P)H nitroreductase {Escherichia coli, minor form, NfnB [TaxId: 562]}
diisvalkrhstkafdaskkltpeqaeqiktllqyspsstnsqpwhfivasteegkarva
ksaagnyvfnerkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkgr
kffadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglkek
gytslvvvpvghhsvedfnatlpksrlpqnitltev

SCOP Domain Coordinates for d1icuc_:

Click to download the PDB-style file with coordinates for d1icuc_.
(The format of our PDB-style files is described here.)

Timeline for d1icuc_: