Lineage for d1icub_ (1icu B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 728985Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 728986Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (2 families) (S)
  5. 728987Family d.90.1.1: NADH oxidase/flavin reductase [55470] (8 proteins)
  6. 729028Protein Oxygen-insensitive NAD(P)H nitroreductase [55476] (3 species)
  7. 729049Species Escherichia coli, minor form, NfnB [TaxId:562] [55478] (12 PDB entries)
  8. 729061Domain d1icub_: 1icu B: [62279]

Details for d1icub_

PDB Entry: 1icu (more details), 1.8 Å

PDB Description: the structure of escherichia coli nitroreductase complexed with nicotinic acid
PDB Compounds: (B:) oxygen-insensitive nad(p)h nitroreductase

SCOP Domain Sequences for d1icub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1icub_ d.90.1.1 (B:) Oxygen-insensitive NAD(P)H nitroreductase {Escherichia coli, minor form, NfnB [TaxId: 562]}
mdiisvalkrhstkafdaskkltpeqaeqiktllqyspsstnsqpwhfivasteegkarv
aksaagnyvfnerkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkg
rkffadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglke
kgytslvvvpvghhsvedfnatlpksrlpqnitltev

SCOP Domain Coordinates for d1icub_:

Click to download the PDB-style file with coordinates for d1icub_.
(The format of our PDB-style files is described here.)

Timeline for d1icub_: