Lineage for d1iccc_ (1icc C:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83540Fold d.120: Cytochrome b5 [55855] (1 superfamily)
  4. 83541Superfamily d.120.1: Cytochrome b5 [55856] (1 family) (S)
  5. 83542Family d.120.1.1: Cytochrome b5 [55857] (4 proteins)
  6. 83543Protein Cytochrome b5 [55858] (3 species)
  7. 83554Species Rat (Rattus norvegicus) [TaxId:10116] [55860] (18 PDB entries)
  8. 83561Domain d1iccc_: 1icc C: [62264]

Details for d1iccc_

PDB Entry: 1icc (more details), 2 Å

PDB Description: rat outer mitochondrial membrane cytochrome b5

SCOP Domain Sequences for d1iccc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iccc_ d.120.1.1 (C:) Cytochrome b5 {Rat (Rattus norvegicus)}
vtyyrleevakrntseetwmvihgrvydltrflsehpggeevlreqagadatesfedvgh
spdaremlkqyyigdvhpndlkp

SCOP Domain Coordinates for d1iccc_:

Click to download the PDB-style file with coordinates for d1iccc_.
(The format of our PDB-style files is described here.)

Timeline for d1iccc_: