SCOP 1.65: Domain d1icca_: 1icc A:

Lineage for d1icca_ (1icc A:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.120: Cytochrome b5 [55855] (1 superfamily)
   small, heme-binding fold

4. Superfamily d.120.1: Cytochrome b5 [55856] (1 family)

5. Family d.120.1.1: Cytochrome b5 [55857] (4 proteins)

6. Protein Cytochrome b5 [55858] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [55860] (20 PDB entries)

8. Domain d1icca_: 1icc A: [62262]

Details for d1icca_

PDB Entry: 1icc, 2 Å

PDB Description: rat outer mitochondrial membrane cytochrome b5

SCOP Domain Sequences for d1icca_:

Sequence; same for both SEQRES and ATOM records:

>d1icca_ d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegicus)}
dpavtyyrleevakrntseetwmvihgrvydltrflsehpggeevlreqagadatesfed
vghspdaremlkqyyigdvhpndlkpk

Timeline for d1icca_:

• d1icca_ first appeared in SCOP 1.57
  
• d1icca_ appears in SCOP 1.63
  
• d1icca_ appears in SCOP 1.67
  
• d1icca_ appears in the current release, SCOPe 2.08