SCOP 1.59: Domain d1ic7h_: 1ic7 H:

Lineage for d1ic7h_ (1ic7 H:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Fab HyHEL-10 (mouse), kappa L chain [48788] (5 PDB entries)

8. Domain d1ic7h_: 1ic7 H: [62258]
   Other proteins in same PDB: d1ic7y_

Details for d1ic7h_

PDB Entry: 1ic7, 2.1 Å

PDB Description: crystal structure of hyhel-10 fv mutant(hd32a99a)-hen lysozyme complex

SCOP Domain Sequences for d1ic7h_:

Sequence; same for both SEQRES and ATOM records:

>d1ic7h_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fab HyHEL-10 (mouse), kappa L chain}
dvqlqesgpslvkpsqtlsltcsvtgdsitsaywswirkfpgnrleymgyvsysgstyyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwagdywgqgtlvtvsaa

Timeline for d1ic7h_:

• d1ic7h_ first appeared in SCOP 1.57
  
• d1ic7h_ appears in SCOP 1.61
  
• d1ic7h_ appears in the current release, SCOPe 2.08