Lineage for d1ic5h_ (1ic5 H:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102741Species Fab HyHEL-10 (mouse), kappa L chain [48788] (5 PDB entries)
  8. 102744Domain d1ic5h_: 1ic5 H: [62254]
    Other proteins in same PDB: d1ic5y_

Details for d1ic5h_

PDB Entry: 1ic5 (more details), 2.3 Å

PDB Description: crystal structure of hyhel-10 fv mutant(hd99a)-hen lysozyme complex

SCOP Domain Sequences for d1ic5h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ic5h_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fab HyHEL-10 (mouse), kappa L chain}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvsysgstyyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwagdywgqgtlvtvsaa

SCOP Domain Coordinates for d1ic5h_:

Click to download the PDB-style file with coordinates for d1ic5h_.
(The format of our PDB-style files is described here.)

Timeline for d1ic5h_: