Lineage for d1ic0f_ (1ic0 F:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 162480Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
  4. 162481Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
  5. 162990Family b.6.1.4: Nitrosocyanin [63392] (2 proteins)
  6. 163004Protein Red copper protein nitrosocyanin [63688] (1 species)
  7. 163005Species Nitrosomonas europaea [TaxId:915] [63689] (3 PDB entries)
  8. 163019Domain d1ic0f_: 1ic0 F: [62246]

Details for d1ic0f_

PDB Entry: 1ic0 (more details), 2.1 Å

PDB Description: red copper protein nitrosocyanin from nitrosomonas europaea

SCOP Domain Sequences for d1ic0f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ic0f_ b.6.1.4 (F:) Red copper protein nitrosocyanin {Nitrosomonas europaea}
nfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspisegf
sidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve

SCOP Domain Coordinates for d1ic0f_:

Click to download the PDB-style file with coordinates for d1ic0f_.
(The format of our PDB-style files is described here.)

Timeline for d1ic0f_: