SCOPe 2.05: Domain d1ic0e_: 1ic0 E:

Lineage for d1ic0e_ (1ic0 E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.4: Nitrosocyanin [63392] (2 proteins)

6. Protein Red copper protein nitrosocyanin [63688] (1 species)

7. Species Nitrosomonas europaea [TaxId:915] [63689] (3 PDB entries)

8. Domain d1ic0e_: 1ic0 E: [62245]
   complexed with cu

Details for d1ic0e_

PDB Entry: 1ic0, 2.1 Å

PDB Description: red copper protein nitrosocyanin from nitrosomonas europaea

PDB Compounds: (E:) nitrosocyanin

SCOPe Domain Sequences for d1ic0e_:

Sequence; same for both SEQRES and ATOM records:

>d1ic0e_ b.6.1.4 (E:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]}
hnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspiseg
fsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve

Timeline for d1ic0e_:

• d1ic0e_ first appeared in SCOP 1.57
  
• d1ic0e_ appears in SCOPe 2.04
  
• d1ic0e_ appears in SCOPe 2.06
  
• d1ic0e_ appears in the current release, SCOPe 2.08