Lineage for d1ic0e_ (1ic0 E:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1114375Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1114376Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1115437Family b.6.1.4: Nitrosocyanin [63392] (2 proteins)
  6. 1115451Protein Red copper protein nitrosocyanin [63688] (1 species)
  7. 1115452Species Nitrosomonas europaea [TaxId:915] [63689] (3 PDB entries)
  8. 1115465Domain d1ic0e_: 1ic0 E: [62245]
    complexed with cu

Details for d1ic0e_

PDB Entry: 1ic0 (more details), 2.1 Å

PDB Description: red copper protein nitrosocyanin from nitrosomonas europaea
PDB Compounds: (E:) nitrosocyanin

SCOPe Domain Sequences for d1ic0e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ic0e_ b.6.1.4 (E:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]}
hnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspiseg
fsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve

SCOPe Domain Coordinates for d1ic0e_:

Click to download the PDB-style file with coordinates for d1ic0e_.
(The format of our PDB-style files is described here.)

Timeline for d1ic0e_: