SCOP 1.61: Domain d1ic0e_: 1ic0 E:

Lineage for d1ic0e_ (1ic0 E:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)

5. Family b.6.1.4: Nitrosocyanin [63392] (2 proteins)

6. Protein Red copper protein nitrosocyanin [63688] (1 species)

7. Species Nitrosomonas europaea [TaxId:915] [63689] (3 PDB entries)

8. Domain d1ic0e_: 1ic0 E: [62245]

Details for d1ic0e_

PDB Entry: 1ic0, 2.1 Å

PDB Description: red copper protein nitrosocyanin from nitrosomonas europaea

SCOP Domain Sequences for d1ic0e_:

Sequence; same for both SEQRES and ATOM records:

>d1ic0e_ b.6.1.4 (E:) Red copper protein nitrosocyanin {Nitrosomonas europaea}
hnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspiseg
fsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve

Timeline for d1ic0e_:

• d1ic0e_ first appeared in SCOP 1.57
  
• d1ic0e_ appears in SCOP 1.59
  
• d1ic0e_ appears in SCOP 1.63
  
• d1ic0e_ appears in the current release, SCOPe 2.08