![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.4: Nitrosocyanin [63392] (2 proteins) |
![]() | Protein Red copper protein nitrosocyanin [63688] (1 species) |
![]() | Species Nitrosomonas europaea [TaxId:915] [63689] (3 PDB entries) |
![]() | Domain d1ic0d_: 1ic0 D: [62244] complexed with cu |
PDB Entry: 1ic0 (more details), 2.1 Å
SCOPe Domain Sequences for d1ic0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ic0d_ b.6.1.4 (D:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} hnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspiseg fsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve
Timeline for d1ic0d_: