Lineage for d1ibzd_ (1ibz D:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 162480Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
  4. 162481Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
  5. 162990Family b.6.1.4: Nitrosocyanin [63392] (2 proteins)
  6. 163004Protein Red copper protein nitrosocyanin [63688] (1 species)
  7. 163005Species Nitrosomonas europaea [TaxId:915] [63689] (3 PDB entries)
  8. 163013Domain d1ibzd_: 1ibz D: [62240]

Details for d1ibzd_

PDB Entry: 1ibz (more details), 2.3 Å

PDB Description: red copper protein nitrosocyanin from nitrosomonas europaea

SCOP Domain Sequences for d1ibzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibzd_ b.6.1.4 (D:) Red copper protein nitrosocyanin {Nitrosomonas europaea}
ehnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspise
gfsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve

SCOP Domain Coordinates for d1ibzd_:

Click to download the PDB-style file with coordinates for d1ibzd_.
(The format of our PDB-style files is described here.)

Timeline for d1ibzd_: