Lineage for d1ibzd_ (1ibz D:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55932Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 55933Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 56339Family b.6.1.4: Nitrosocyanin [63392] (2 proteins)
  6. 56353Protein Red copper protein nitrosocyanin [63688] (1 species)
  7. 56354Species Nitrosomonas europaea [TaxId:915] [63689] (3 PDB entries)
  8. 56362Domain d1ibzd_: 1ibz D: [62240]

Details for d1ibzd_

PDB Entry: 1ibz (more details), 2.3 Å

PDB Description: red copper protein nitrosocyanin from nitrosomonas europaea

SCOP Domain Sequences for d1ibzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibzd_ b.6.1.4 (D:) Red copper protein nitrosocyanin {Nitrosomonas europaea}
ehnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspise
gfsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve

SCOP Domain Coordinates for d1ibzd_:

Click to download the PDB-style file with coordinates for d1ibzd_.
(The format of our PDB-style files is described here.)

Timeline for d1ibzd_: