Class b: All beta proteins [48724] (177 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.4: Nitrosocyanin [63392] (2 proteins) |
Protein Red copper protein nitrosocyanin [63688] (1 species) |
Species Nitrosomonas europaea [TaxId:915] [63689] (3 PDB entries) |
Domain d1ibzc_: 1ibz C: [62239] complexed with cu |
PDB Entry: 1ibz (more details), 2.3 Å
SCOPe Domain Sequences for d1ibzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ibzc_ b.6.1.4 (C:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} nfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspisegf sidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve
Timeline for d1ibzc_: