Lineage for d1ibzc_ (1ibz C:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 224388Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 224389Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 224942Family b.6.1.4: Nitrosocyanin [63392] (2 proteins)
  6. 224956Protein Red copper protein nitrosocyanin [63688] (1 species)
  7. 224957Species Nitrosomonas europaea [TaxId:915] [63689] (3 PDB entries)
  8. 224964Domain d1ibzc_: 1ibz C: [62239]

Details for d1ibzc_

PDB Entry: 1ibz (more details), 2.3 Å

PDB Description: red copper protein nitrosocyanin from nitrosomonas europaea

SCOP Domain Sequences for d1ibzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibzc_ b.6.1.4 (C:) Red copper protein nitrosocyanin {Nitrosomonas europaea}
nfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspisegf
sidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve

SCOP Domain Coordinates for d1ibzc_:

Click to download the PDB-style file with coordinates for d1ibzc_.
(The format of our PDB-style files is described here.)

Timeline for d1ibzc_: