Lineage for d1ibyc_ (1iby C:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106628Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 106629Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 107100Family b.6.1.4: Nitrosocyanin [63392] (2 proteins)
  6. 107114Protein Red copper protein nitrosocyanin [63688] (1 species)
  7. 107115Species Nitrosomonas europaea [TaxId:915] [63689] (3 PDB entries)
  8. 107118Domain d1ibyc_: 1iby C: [62235]

Details for d1ibyc_

PDB Entry: 1iby (more details), 1.65 Å

PDB Description: red copper protein nitrosocyanin from nitrosomonas europaea

SCOP Domain Sequences for d1ibyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibyc_ b.6.1.4 (C:) Red copper protein nitrosocyanin {Nitrosomonas europaea}
ehnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspise
gfsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve

SCOP Domain Coordinates for d1ibyc_:

Click to download the PDB-style file with coordinates for d1ibyc_.
(The format of our PDB-style files is described here.)

Timeline for d1ibyc_: