Lineage for d1ibya_ (1iby A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 369112Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 369113Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 369721Family b.6.1.4: Nitrosocyanin [63392] (2 proteins)
  6. 369735Protein Red copper protein nitrosocyanin [63688] (1 species)
  7. 369736Species Nitrosomonas europaea [TaxId:915] [63689] (3 PDB entries)
  8. 369737Domain d1ibya_: 1iby A: [62233]

Details for d1ibya_

PDB Entry: 1iby (more details), 1.65 Å

PDB Description: red copper protein nitrosocyanin from nitrosomonas europaea

SCOP Domain Sequences for d1ibya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea}
ehnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspise
gfsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve

SCOP Domain Coordinates for d1ibya_:

Click to download the PDB-style file with coordinates for d1ibya_.
(The format of our PDB-style files is described here.)

Timeline for d1ibya_: