SCOPe 2.07: Domain d1ibxb_: 1ibx B:

Lineage for d1ibxb_ (1ibx B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (3 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.1: CAD domain [54278] (3 proteins)

6. Protein Inhibitor of caspase-activated DNase (ICAD), DFF45, N-terminal domain [54283] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64224] (1 PDB entry)

8. Domain d1ibxb_: 1ibx B: [62232]
   Other proteins in same PDB: d1ibxa1, d1ibxa2
   chimera with B1 domain of streptococcal protein G (disordered)

Details for d1ibxb_

PDB Entry: 1ibx

PDB Description: nmr structure of dff40 and dff45 n-terminal domain complex

PDB Compounds: (B:) chimera of igg binding protein g and DNA fragmentation factor 45

SCOPe Domain Sequences for d1ibxb_:

Sequence; same for both SEQRES and ATOM records:

>d1ibxb_ d.15.2.1 (B:) Inhibitor of caspase-activated DNase (ICAD), DFF45, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
sgeirtlkpcllrrnysreqhgvaascledlrskacdilaidksltpvtlvlaedgtivd
dddyflclpsntkfvalasnekwaynnsd

Timeline for d1ibxb_:

• d1ibxb_ first appeared in SCOP 1.57
  
• d1ibxb_ appears in SCOPe 2.06
  
• d1ibxb_ appears in the current release, SCOPe 2.08