SCOP 1.57: Domain d1ibxb_: 1ibx B:

Lineage for d1ibxb_ (1ibx B:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.2: CAD & PB1 domains [54277] (2 families)

5. Family d.15.2.1: CAD domain [54278] (3 proteins)

6. Protein Inhibitor of caspase-activated DNase (ICAD), DFF45, N-terminal domain [54283] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64224] (1 PDB entry)

8. Domain d1ibxb_: 1ibx B: [62232]
   Other proteins in same PDB: d1ibxa_

Details for d1ibxb_

PDB Entry: 1ibx

PDB Description: nmr structure of dff40 and dff45 n-terminal domain complex

SCOP Domain Sequences for d1ibxb_:

Sequence; same for both SEQRES and ATOM records:

>d1ibxb_ d.15.2.1 (B:) Inhibitor of caspase-activated DNase (ICAD), DFF45, N-terminal domain {Human (Homo sapiens)}
sgeirtlkpcllrrnysreqhgvaascledlrskacdilaidksltpvtlvlaedgtivd
dddyflclpsntkfvalasnekwaynnsd

Timeline for d1ibxb_:

• d1ibxb_ is new in SCOP 1.57
  
• d1ibxb_ appears in SCOP 1.59
  
• d1ibxb_ appears in the current release, SCOPe 2.08