SCOPe 2.07: Domain d1ibxa1: 1ibx A:1-80

Lineage for d1ibxa1 (1ibx A:1-80)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (3 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.1: CAD domain [54278] (3 proteins)

6. Protein Caspase-activated DNase (CAD), DFF40, N-terminal domain [54281] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64223] (1 PDB entry)

8. Domain d1ibxa1: 1ibx A:1-80 [62231]
   Other proteins in same PDB: d1ibxa2, d1ibxb_

Details for d1ibxa1

PDB Entry: 1ibx

PDB Description: nmr structure of dff40 and dff45 n-terminal domain complex

PDB Compounds: (A:) DNA fragmentation factor 40

SCOPe Domain Sequences for d1ibxa1:

Sequence; same for both SEQRES and ATOM records:

>d1ibxa1 d.15.2.1 (A:1-80) Caspase-activated DNase (CAD), DFF40, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mlqkpksvklralrsprkfgvagrscqevlrkgclrfqlpergsrlclyedgteltedyf
psvpdnaelvlltlgqawqg

Timeline for d1ibxa1:

• d1ibxa1 first appeared in SCOP 1.57, called d1ibxa_
  
• d1ibxa1 appears in SCOPe 2.06
  
• d1ibxa1 appears in the current release, SCOPe 2.08