Class b: All beta proteins [48724] (174 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
Protein Acid protease [50649] (9 species) |
Species Fungus (Aspergillus phoenicis), aspergillopepsin [TaxId:5063] [63794] (1 PDB entry) |
Domain d1ibqb_: 1ibq B: [62230] complexed with man, zn |
PDB Entry: 1ibq (more details), 2.14 Å
SCOPe Domain Sequences for d1ibqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ibqb_ b.50.1.2 (B:) Acid protease {Fungus (Aspergillus phoenicis), aspergillopepsin [TaxId: 5063]} skgsavttpqnndeeyltpvtvgkstlhldfdtgsadlwvfsdelpsseqtghdlytpss satklsgyswdisygdgssasgdvyrdtvtvggvttnkqaveaaskissefvqdtandgl lglafssintvqpkaqttffdtvksqldsplfavqlkhdapgvydfgyiddskytgsity tdadssqgywgfstdgysigdgsssssgfsaiadtgttlillddeivsayyeqvsgaqes yeaggyvfscstdlpdftvvigdykavvpgkyinyapvstgsstcyggiqsnsglglsil gdvflksqyvvfnsegpklgfaaqa
Timeline for d1ibqb_: