Lineage for d1ibqb_ (1ibq B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 466492Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 466493Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 466917Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 466918Protein Acid protease [50649] (9 species)
  7. 466944Species Fungus (Aspergillus phoenicis), aspergillopepsin [TaxId:5063] [63794] (1 PDB entry)
  8. 466946Domain d1ibqb_: 1ibq B: [62230]

Details for d1ibqb_

PDB Entry: 1ibq (more details), 2.14 Å

PDB Description: aspergillopepsin from aspergillus phoenicis

SCOP Domain Sequences for d1ibqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibqb_ b.50.1.2 (B:) Acid protease {Fungus (Aspergillus phoenicis), aspergillopepsin}
skgsavttpqnndeeyltpvtvgkstlhldfdtgsadlwvfsdelpsseqtghdlytpss
satklsgyswdisygdgssasgdvyrdtvtvggvttnkqaveaaskissefvqdtandgl
lglafssintvqpkaqttffdtvksqldsplfavqlkhdapgvydfgyiddskytgsity
tdadssqgywgfstdgysigdgsssssgfsaiadtgttlillddeivsayyeqvsgaqes
yeaggyvfscstdlpdftvvigdykavvpgkyinyapvstgsstcyggiqsnsglglsil
gdvflksqyvvfnsegpklgfaaqa

SCOP Domain Coordinates for d1ibqb_:

Click to download the PDB-style file with coordinates for d1ibqb_.
(The format of our PDB-style files is described here.)

Timeline for d1ibqb_: