SCOPe 2.06: Domain d1ibqa_: 1ibq A:

Lineage for d1ibqa_ (1ibq A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Acid protease [50649] (9 species)

7. Species Fungus (Aspergillus phoenicis), aspergillopepsin [TaxId:5063] [63794] (1 PDB entry)

8. Domain d1ibqa_: 1ibq A: [62229]
   complexed with man, zn

Details for d1ibqa_

PDB Entry: 1ibq, 2.14 Å

PDB Description: aspergillopepsin from aspergillus phoenicis

PDB Compounds: (A:) aspergillopepsin

SCOPe Domain Sequences for d1ibqa_:

Sequence; same for both SEQRES and ATOM records:

>d1ibqa_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus phoenicis), aspergillopepsin [TaxId: 5063]}
skgsavttpqnndeeyltpvtvgkstlhldfdtgsadlwvfsdelpsseqtghdlytpss
satklsgyswdisygdgssasgdvyrdtvtvggvttnkqaveaaskissefvqdtandgl
lglafssintvqpkaqttffdtvksqldsplfavqlkhdapgvydfgyiddskytgsity
tdadssqgywgfstdgysigdgsssssgfsaiadtgttlillddeivsayyeqvsgaqes
yeaggyvfscstdlpdftvvigdykavvpgkyinyapvstgsstcyggiqsnsglglsil
gdvflksqyvvfnsegpklgfaaqa

Timeline for d1ibqa_:

• d1ibqa_ first appeared in SCOP 1.57
  
• d1ibqa_ appears in SCOPe 2.05
  
• d1ibqa_ appears in SCOPe 2.07
  
• d1ibqa_ appears in the current release, SCOPe 2.08