SCOP 1.69: Domain d1ibqa_: 1ibq A:

Lineage for d1ibqa_ (1ibq A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.2: Pepsin-like [50646] (10 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Acid protease [50649] (9 species)

7. Species Fungus (Aspergillus phoenicis), aspergillopepsin [TaxId:5063] [63794] (1 PDB entry)

8. Domain d1ibqa_: 1ibq A: [62229]

Details for d1ibqa_

PDB Entry: 1ibq, 2.14 Å

PDB Description: aspergillopepsin from aspergillus phoenicis

SCOP Domain Sequences for d1ibqa_:

Sequence; same for both SEQRES and ATOM records:

>d1ibqa_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus phoenicis), aspergillopepsin}
skgsavttpqnndeeyltpvtvgkstlhldfdtgsadlwvfsdelpsseqtghdlytpss
satklsgyswdisygdgssasgdvyrdtvtvggvttnkqaveaaskissefvqdtandgl
lglafssintvqpkaqttffdtvksqldsplfavqlkhdapgvydfgyiddskytgsity
tdadssqgywgfstdgysigdgsssssgfsaiadtgttlillddeivsayyeqvsgaqes
yeaggyvfscstdlpdftvvigdykavvpgkyinyapvstgsstcyggiqsnsglglsil
gdvflksqyvvfnsegpklgfaaqa

Timeline for d1ibqa_:

• d1ibqa_ first appeared in SCOP 1.57
  
• d1ibqa_ appears in SCOP 1.67
  
• d1ibqa_ appears in SCOP 1.71
  
• d1ibqa_ appears in the current release, SCOPe 2.08