Lineage for d1ibmt_ (1ibm T:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 627045Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 627046Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 627047Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 627048Protein 70S ribosome functional complex [58121] (3 species)
  7. 627637Species Thermus thermophilus [TaxId:274] [58122] (10 PDB entries)
  8. 627678Domain d1ibmt_: 1ibm T: [62225]

Details for d1ibmt_

PDB Entry: 1ibm (more details), 3.31 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site

SCOP Domain Sequences for d1ibmt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibmt_ i.1.1.1 (T:) 70S ribosome functional complex {Thermus thermophilus}
rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOP Domain Coordinates for d1ibmt_:

Click to download the PDB-style file with coordinates for d1ibmt_.
(The format of our PDB-style files is described here.)

Timeline for d1ibmt_: