Lineage for d1ibms_ (1ibm S:)

  1. Root: SCOP 1.65
  2. 345885Class i: Low resolution protein structures [58117] (18 folds)
  3. 345886Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 345887Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 345888Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 345889Protein 70S ribosome functional complex [58121] (2 species)
  7. 346163Species Thermus thermophilus [TaxId:274] [58122] (10 PDB entries)
  8. 346224Domain d1ibms_: 1ibm S: [62224]

Details for d1ibms_

PDB Entry: 1ibm (more details), 3.31 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site

SCOP Domain Sequences for d1ibms_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibms_ i.1.1.1 (S:) 70S ribosome functional complex {Thermus thermophilus}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyrghgkeak

SCOP Domain Coordinates for d1ibms_:

Click to download the PDB-style file with coordinates for d1ibms_.
(The format of our PDB-style files is described here.)

Timeline for d1ibms_: