Lineage for d1ibmp_ (1ibm P:)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1467790Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1467791Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1467792Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1467793Protein 70S ribosome functional complex [58121] (9 species)
  7. 1468440Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 1468507Domain d1ibmp_: 1ibm P: [62221]
    protein/RNA complex; complexed with mg, zn

Details for d1ibmp_

PDB Entry: 1ibm (more details), 3.31 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d1ibmp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibmp_ i.1.1.1 (P:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOPe Domain Coordinates for d1ibmp_:

Click to download the PDB-style file with coordinates for d1ibmp_.
(The format of our PDB-style files is described here.)

Timeline for d1ibmp_: