Lineage for d1ibli_ (1ibl I:)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2268315Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2268316Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2268317Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2268318Protein 70S ribosome functional complex [58121] (4 species)
  7. 2268875Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 2268891Domain d1ibli_: 1ibl I: [62193]
    protein/RNA complex; complexed with mg, par, zn

Details for d1ibli_

PDB Entry: 1ibl (more details), 3.11 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
PDB Compounds: (I:) 30S ribosomal protein S9

SCOPe Domain Sequences for d1ibli_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibli_ i.1.1.1 (I:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOPe Domain Coordinates for d1ibli_:

Click to download the PDB-style file with coordinates for d1ibli_.
(The format of our PDB-style files is described here.)

Timeline for d1ibli_: