Lineage for d1iblf_ (1ibl F:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1710353Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1710354Protein 70S ribosome functional complex [58121] (9 species)
  7. 1711001Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 1711014Domain d1iblf_: 1ibl F: [62190]
    protein/RNA complex; complexed with mg, par, zn

Details for d1iblf_

PDB Entry: 1ibl (more details), 3.11 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d1iblf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iblf_ i.1.1.1 (F:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOPe Domain Coordinates for d1iblf_:

Click to download the PDB-style file with coordinates for d1iblf_.
(The format of our PDB-style files is described here.)

Timeline for d1iblf_: