Lineage for d1ibks_ (1ibk S:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 753710Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 753711Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 753712Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 753713Protein 70S ribosome functional complex [58121] (3 species)
  7. 754252Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries)
  8. 754290Domain d1ibks_: 1ibk S: [62182]

Details for d1ibks_

PDB Entry: 1ibk (more details), 3.31 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
PDB Compounds: (S:) 30S ribosomal protein S19

SCOP Domain Sequences for d1ibks_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibks_ i.1.1.1 (S:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOP Domain Coordinates for d1ibks_:

Click to download the PDB-style file with coordinates for d1ibks_.
(The format of our PDB-style files is described here.)

Timeline for d1ibks_: